peptide synthetics

Activity value 61 england Supplier, the last transaction date was 2019-11-05 Address: peptide protein reserch ltd bridge house farm,184 funtlev road,,fareham po15 united kingdom Detail
Accurate Match

Bill of lading data

< 1/15 >
Only shown the last 15 items, click more to check all
  • Trade date 2019/11/05 B/L No. ——
  • Supplier peptide synthetics Buyers rajiv gandhi centre for bio
  • POLs —— PODs cochin
  • Supply area England Purchas area India
  • Weight —— Amount 686.951
  • Hs code 38220019 Product tags widal,vag,gf,lp,reagents,fff
  • Product description MGNATFFFETMSNVAGWIDALSCLIGLLPNFLQAFGF(LAB REAGENTS FOR R&D PURPOSE
+View All

Products

  • Products Transactions Per Detail
  • reagents
    18 90% >
  • kkk
    6 30% >
  • peptide
    5 25% >
  • sequence
    5 25% >
  • gf
    4 20% >
  • +View All

Hscode rank

  • HSCode Name Transactions Per Detail
  • 38220019 12 60% >
  • 38220090 8 40% >
peptide synthetics is A England Supplier. This Company's Trade Report Mainly Contains Market Analysis, Contact, Trade Partners, Ports Statistics, And Trade Area Analysis. Official Reference Contact Is From England Original Bill Of Ladings, Including Email, Phone, Fax, Address, And Official Website. Till 2019-11-05,peptide synthetics. A Total Of 20 Transactions. Follow Up The Company, And Then Can Export This Company's Contact And B/Ls. If There Is New Transactions, We Will Also Inform You By The System.

We Extract The Trade Partners From peptide synthetics'S 20 Transctions. You Can Screen Companies By Transactions, Trade Date, And Trading Area. While You Can Check Product Type, Quantity, Price, And Trade Frequency Of Each Transaction. This Data Will Help You Study Your Competitors, Maintain And Monitor Your Customers, And Develop Target Users. Through Summary Statistics Of Transaction,We Extract This Company's Data Of Import-Export Ports And Trade Area, And Then You Can Check Related Data. It Can Calculate The Main Market And Occupation Of peptide synthetics. All Around The World. Help You Deeply Analyze The Target Market, And Scientifically Formulate Production And Marketing Strategies.

Besides, We Are Trying Our Best To Provide Accurate Target Customers Recommend. Through Big Data, Recommend The Company That Buying Or Supplying The Same Product (Or HS Code) From The England's Supplier Company Database. That Including Email And Have Transaction Recently Will Be Pushed. So Suggest You Follow peptide synthetics, At The Same Time, Mark This Company's Industry And Products, It Will Help You Receive More Accurate Data Push.

Reference contact info

Business Information


Peer companies

Whatsapp:+8616621075894(9:00 Am-18:00 Pm (SGT))

About us Contact us Advertise Buyer Supplier Company report Industry report

©2010-2024 52wmb.com all rights reserved